DPCstruct | MC36025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2141 |
|---|---|
| Mean domain length (aa) | 254 ± 44 aa |
| Standard deviation of domain lengths | 43.61 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.32 |
| Mean intra-cluster sequence similarity (%) | 9.30 |
| Pfam Score | 70.04 |
| Assigned Pfam label(s) | PF18951- PF14742- CL0194- CL0177- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5YDM1 | 21-277 | DSGNIRQAGEGRYILENEYLEVELNALKGGGIENIRYKPANTSLTGGSQGISFEDRIYRQRREGSNRLVETEYFISRPYSVKILKDT… |
| A0A641W7B2 | 45-282 | PTIARPWGMNFWTPQTGKMGDGWQYVYTANKIRGFKQTHQPSPWINDYGQFSIMPMVGKPEFDEEKRASWFGHKGEEATPYYYKVYL… |
| A0A7J9RKU6 | 710-1043 | None |
| A0A4Q2XEJ4 | 4-258 | None |
| A0A450SDR9 | 261-577 | None |
| A0A3N5WI94 | 385-621 | None |
| A0A0S8AJR1 | 440-640 | None |
| A0A0B5HXB5 | 131-312 | None |
| A0A7V9GGC0 | 93-356 | None |
| A0A3R8NS16 | 137-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.