DPCstruct | MC36021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Standard deviation of domain lengths | 7.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4AUR5 | 2-96 | EELYQRFLDGEDSHVTQEDDPFWDPVEVIHLGSAHVWLQSLAYCMKFEEQVEFLNCDGLEEAVLHIHMASCSPTGQAHGEEDVVIDP… |
| A0A2C9LBM5 | 68-167 | FQNYTEGDPDWNVPKEKDPFWEPVSTPVLIGTSLVYLQPLAYLIDMDESLAVIDWKGKEIGQLLVSLVPCDSKWEPLSDSSYVEDPK… |
| A0A816RXR4 | 235-337 | None |
| A0A2H2ITV0 | 38-146 | None |
| U6K636 | 29-126 | None |
| A0A1S3J029 | 151-261 | None |
| A0A448WSP1 | 22-121 | None |
| A0A4W3IQH6 | 4-86 | None |
| A0A183RGG0 | 265-370 | None |
| F6VIA3 | 82-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.