DPCstruct | MC3602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A128F8T4 | 1-76 | MIKVVSIPRIAAHAGSPFNLIHVRLYWVCPQCGDERGELVGTTSYDGSCRLYCDGWSNPCGHVDKYSAVKKEALAN |
| A0A5D0QQR4 | 112-193 | ETGQIRVKVRDYSAEAPWGVGLTNPVVRAIVISAYCVVCGCPRGMPRRIHQCDDGVHYWPDVWNNPCGHTDMYEAVIKEAEE |
| A0A2A5DNZ7 | 1-77 | None |
| A0A2B8JAK1 | 1-74 | None |
| A0A124E5W9 | 10-89 | None |
| A0A402C322 | 1-65 | None |
| A0A2T4Z8Y1 | 1-66 | None |
| A0A5C7UHJ0 | 5-79 | None |
| A0A5S4F2B6 | 2-91 | None |
| A0A0N1GVE3 | 85-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.