DPCstruct | MC36018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 176 ± 25 aa |
| Standard deviation of domain lengths | 25.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0651 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7EZ93 | 2-153 | ELEGVFRHLEAIFNLTLVPRILILLGGNAMSPKELYEINLEGISVGNAEESLQTPTCVRKLFHSLFLADVFSELQVVPAMGTIVMVQ… |
| A0A5E4A937 | 28-194 | AVRKKPRVTTEASNRKCQQALAELESVLSHLEELFARTLVPRVLILLGGSALSPKEFYELDLSRLVPFSMDQNLSTAACLRRLFRAI… |
| A0A2A3ESB2 | 59-274 | None |
| A0A072U220 | 15-173 | None |
| F7B4R2 | 28-176 | None |
| A0A674BDK8 | 163-366 | None |
| B9S436 | 74-224 | None |
| A0A6J2K8R6 | 38-208 | None |
| A0A498IQ61 | 889-1078 | None |
| A0A6G0HN56 | 151-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.