DPCstruct | MC36013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 289 |
|---|---|
| Mean domain length (aa) | 88 ± 15 aa |
| Standard deviation of domain lengths | 15.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF09356- PF10162- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L0PQA8 | 3-100 | TWANNMLTTLSAGITASATSMTVASMGDLVLGVNETAFLTLQNDAASLYEIVKVTEISGLTLTIQRAQEGTTAQAWEVGAIVVAAQT… |
| A0A660W516 | 14-84 | IQQNATRLAQALAQGSTTMYIEKDVFSDNDVVTVGEEDILITAHGTTCTVTRAQNGTTDSAHASGANVRLA |
| A0A7U5BFS8 | 871-959 | None |
| A0A2J0LFS3 | 154-232 | None |
| A0A7K3IUQ8 | 2-92 | None |
| A0A133VQ15 | 1-119 | None |
| A0A0V9UNT0 | 8-88 | None |
| A0A1I1E164 | 15-127 | None |
| A0A2P9I3J5 | 102-183 | None |
| A0A497NQ71 | 71-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.