DPCstruct | MC36012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 96 ± 18 aa |
| Standard deviation of domain lengths | 18.01 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A857V8Y1 | 1-76 | MLRVNFQTGGTATTERNGVFIEDLLIVAYAKLAGYNRELPCRENSVALTKIEEAIMWLANRKAEREARGVYGTEEK |
| A0A2L0PM96 | 20-108 | NPGHDYQIDFGDSSHEISFQNGPVKEHGVNGITSEALLAILIHRTEVLNSNFPCAENEAALDGLNQALNAFESRTQNRIDRGVEGEN… |
| A0A563D5Q5 | 15-106 | None |
| A0A4Q3TS20 | 14-95 | None |
| A0A5B5VQ56 | 78-196 | None |
| A0A3A9A945 | 7-122 | None |
| A0A0U1KVR7 | 13-101 | None |
| A0A842HFU5 | 118-239 | None |
| A0A2D9KF65 | 26-109 | None |
| A0A0F9I2E6 | 39-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.