DPCstruct | MC3601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 88 ± 5 aa |
| Standard deviation of domain lengths | 4.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4I845 | 96-185 | LTKEATERYKNPDQDPRGPWQSVTANVQAGHATPQQFYTIISPGGKTHNPPKGRCWVYPEYRMIQEISANNIWFGKDGNGVPRIKKF… |
| A0A5D0QPZ9 | 306-388 | SRAYRNSDDDPRGPWIFADLTSGSERAQGADFQYPVTSPSGRVFMPSPQRGWKVLQERFLEMDTQGRIYWGKNGDRRPVLKKF |
| A0A7I6PZM1 | 88-175 | None |
| C6EQX4 | 240-324 | None |
| A0A135VK05 | 215-299 | None |
| A0A4U8SBK1 | 1-100 | None |
| I0ZFC4 | 17-107 | None |
| A0A2M8EJ48 | 151-245 | None |
| A0A154TGT4 | 58-143 | None |
| A0A3N3DQY0 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.