DPCstruct | MC36004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 160 ± 21 aa |
| Standard deviation of domain lengths | 21.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 63.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G2FYH6 | 1-150 | MERPVKRQRITLDSLGTDDEDELDCEPNELNQRRDPVYQLEQARARASNKLKSRFENIFARYEKDFTGVGDEIDLRTGEIVVNNGHL… |
| C0NG62 | 4-133 | AERPRKRARILGLWDSDVGDVASEIDVSAARQANDLRLKSRFEDIFEKYGKDFSSVGDEIDLATGNIVIDNGHIERMKNEQDLGSQP… |
| A0A165JDV7 | 1-157 | None |
| A0A423XF12 | 1-179 | None |
| Q9HDY7 | 4-192 | None |
| T5AAL6 | 1-172 | None |
| A0A2A9PJQ6 | 1-184 | None |
| A0A0B1PAE9 | 1-157 | None |
| A0A2J8C5Q4 | 1-158 | None |
| A0A1B8CWZ7 | 58-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.