DPCstruct | MC36002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 168 ± 17 aa |
| Standard deviation of domain lengths | 17.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J7IP49 | 11-170 | YKSDEYGPVLEATIAENREKLDSGLGDQLFAKYRATENEYGGKYRLILVGALMMRAGAKIKDEDMQHLRDLVPQINCNEGYTLPLMD… |
| A0A0G2FEX5 | 23-198 | CTMGLTSDGDDEYDAEKELESPAFRKKLDAGLCDKLFKDCRSNENGGFLLSLFPDGKMRTVLLAAMVMQSGAKISDDNMQHLREIVP… |
| A0A1L7X5C1 | 60-218 | None |
| A0A1Y2U1V3 | 43-245 | None |
| A0A4U6XSD9 | 275-448 | None |
| A0A0L0HG63 | 195-376 | None |
| A0A5N5IVP4 | 1-165 | None |
| A0A2V5HD80 | 4-171 | None |
| A0A1Y2XDR6 | 3-163 | None |
| A0A4Q4WCH8 | 40-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.