DPCstruct | MC360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 237 ± 29 aa |
| Standard deviation of domain lengths | 29.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 65.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3W2S4 | 381-603 | ILRNGMWTNTELKISDSKEKTTEESEKKREEYKKEEAKRKEKVRIEIAEAWDSILLAQVIRGFLLVTQSILRKYIILPSLIIVKNTA… |
| A0A3P6G4J3 | 26-267 | RKTVIWEFLQAKAHSPLFFDRIDKFFFFSFDIWGLKKKILRNFMWKKKFFFDKNEEEQSKKEEQRRIEIAETWDSFLFAQIIRGFIL… |
| A0A830D793 | 37-258 | None |
| A0A1L2BNU1 | 463-721 | None |
| P0C262 | 360-661 | None |
| A0A411K0A6 | 752-1001 | None |
| A2Q584 | 134-364 | None |
| Q85WU2 | 991-1188 | None |
| A0A6A5MPS3 | 527-763 | None |
| A0A0G3FH78 | 744-986 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.