DPCstruct | MC36
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 174 ± 34 aa |
| Standard deviation of domain lengths | 34.14 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WHV0 | 2-177 | ADLYAVINTLQNLEKAYIKDRVAAKEYTAACSKLLVQYKAAMRQVQSDEFPNVEVFMRRFRLDCPAAMERIREDRPITIKDDKGSTN… |
| A0A6J3BKQ6 | 75-244 | WPPEPAGCFTGSQPLLAWEPLETSRSYMRYDNMAELFAVVKTMQALEKAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSID… |
| R9AE57 | 12-183 | None |
| A0A8B6CW98 | 2-110 | None |
| A0A7J8RN45 | 12-202 | None |
| L1JZP9 | 37-205 | None |
| A0A5J5CTW2 | 35-212 | None |
| A0A7J6PEU6 | 12-212 | None |
| A0A6A3AS04 | 1-103 | None |
| A0A6S7NB27 | 36-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.