DPCstruct | MC35996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 148 ± 17 aa |
| Standard deviation of domain lengths | 17.32 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 24.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0H208 | 1-155 | MYKFLVLLFSVLSFDTVAFASSQIDSVEKELQLLLNRKSQFESKKIETISRFKEALKTTKNLHDKYVLHLNLYHEFRKYQIDSAIFY… |
| A0A5C8GCY0 | 16-172 | SVPASRYDYNELDRLIAQRTQTTEAKERRIDSIRQQLADPHLQPEQRLDICKKLYSEYECFRFDSAAVYADRVLHYARQLNDSRKVQ… |
| A0A6I3RLE1 | 1-169 | None |
| A0A1Y3VG05 | 12-145 | None |
| A0A173R0A3 | 1-158 | None |
| A0A1Q6HIG1 | 2-138 | None |
| A0A7K1M1C7 | 5-108 | None |
| R5KZD3 | 1-156 | None |
| A0A3N2MEZ0 | 1-132 | None |
| A0A086F4H8 | 3-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.