DPCstruct | MC35995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 467 ± 39 aa |
| Standard deviation of domain lengths | 39.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 12.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0JZA3 | 159-653 | ASQIFAEYMANIIKHIPDPGTLTMLTGTANSQASFFFQSSTTNEINANLYNNILSPRVKGGDSPFGVNQAELLSAAFTNAYLQVYLS… |
| A0A6B0TJT9 | 4-416 | NEKIVRALYTILEDSLFLGDRLTKSEFGLLMQPGQFVSTQLRETDSSEDMAIQAELIDDIMDTSFLFRPQIGTVSQKYFEVLEYAAL… |
| A0A7V9GIU6 | 60-523 | None |
| A0A2I0RI06 | 15-456 | None |
| A0A6M7ZR77 | 9-492 | None |
| A0A6M7YPA3 | 6-443 | None |
| A0A316X1N8 | 9-505 | None |
| A0A6V6YK71 | 21-516 | None |
| A0A5C4SK29 | 1-440 | None |
| A0A0J9WSI5 | 11-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.