DPCstruct | MC35991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 170 ± 27 aa |
| Standard deviation of domain lengths | 26.90 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2R5N2 | 4-165 | NLIHFSPTANLTASENLAEFIRMCKEDLTVFSADLDWEATAWPKAANFTKLGVSARGFTESDRLDDSLIDFAKAYFRYQQGHHPTGT… |
| A0A3S4IC36 | 1-163 | MLFLFKSKNNLRQKNNYNEFIQFCRYQLSGLTQTQDWEQYVWKGYVTFRKIGVGHKVFNSKDAMHEDFLDFAKAYIRYQHSLKPLKN… |
| A0A7I8I2V7 | 3-163 | None |
| A0A379AK70 | 1-164 | None |
| A0A376SH75 | 5-165 | None |
| A0A2U0TD13 | 2-130 | None |
| A0A7I8I0A1 | 1-232 | None |
| A0A6H3CL68 | 1-139 | None |
| A0A377BCN7 | 1-189 | None |
| A0A4Q1J7J2 | 11-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.