DPCstruct | MC35990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 14 aa |
| Standard deviation of domain lengths | 13.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381HAV6 | 1-78 | MPVFSFMGNASQHPQQVPCYITHTNEKTHDVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFAIATNIRSSWNRKD |
| A0A804N7A4 | 1-62 | MCCYLTRTTKETHQIVIDNLDETPTYGGWVEAKGPRYCPSIEDKIVRFKDKESHQIFLEPEG |
| A0A2S6BAR9 | 1-80 | None |
| A0A1V5PTK9 | 51-113 | None |
| A0A377B470 | 19-96 | None |
| A0A2N5V6N6 | 121-218 | None |
| E7G4A0 | 193-290 | None |
| A0A7V1P3D0 | 2-95 | None |
| A0A0M3JPJ7 | 1-86 | None |
| A0A336MHQ8 | 230-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.