DPCstruct | MC35989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 242 ± 46 aa |
| Standard deviation of domain lengths | 45.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.34 |
| Pfam Score | 84.16 |
| Assigned Pfam label(s) | CL0123- CL0031- CL0166- PF03123- CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377F4W6 | 1-185 | MQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMHLVSAQMSGNMEDVAGV… |
| A0A381H917 | 2-235 | PEQLQPILQEIFTRFRIRLTDEGELFLRLYCAVAVRRISEGYPLSEFTTEEVEDNVCFAARDIAAVLQHLADKPLSASEENWLKVHI… |
| A0A5N1BFI8 | 1-273 | None |
| A0A645G4P3 | 7-219 | None |
| A0A6N6XDP6 | 103-334 | None |
| A0A1S1BP42 | 14-319 | None |
| D7UWU4 | 58-245 | None |
| A0A3F3GSM4 | 4-267 | None |
| A0A7H4SH90 | 8-194 | None |
| A0A645BR75 | 57-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.