DPCstruct | MC35984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 132 ± 20 aa |
| Standard deviation of domain lengths | 20.07 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 21.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381GZV8 | 12-122 | ELNLRFDRLPRHIRRWALYLHHITGVSVEIIVVTLLAFLGLACQDMFCVQLGNKQRFPLALYMLLLSRSGSGKSRIYRLLKIPVEQR… |
| A0A222B867 | 10-133 | FPLSSLPPLIRDAVIEAQQITQAPLGLVAASALGAVSLVCQNLIDVCRLNTLRGPVSLFFLTLAESGERKTAVDKLLMKPLYQQEMQ… |
| A0A1Q3PBX7 | 220-386 | None |
| A0A239PNP5 | 27-154 | None |
| V7F0Y9 | 475-613 | None |
| A0A1M5JLE6 | 22-133 | None |
| A0A4R4U382 | 31-167 | None |
| A0A850R8R6 | 565-713 | None |
| A0A7D9DI08 | 1-147 | None |
| A0A553ACX2 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.