DPCstruct | MC3598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 325 ± 18 aa |
| Standard deviation of domain lengths | 18.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.72 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0175- CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7QAC6 | 17-371 | PRIKLVIALLLEQHADVNVVTNNVTCFTVLMRAKFKHWDIIELLIAHGARDDLGSLNGLVLSKEEKKHISELLRTRPSKRPPRPCPC… |
| A0A7S3Y0B2 | 76-393 | SMGMVKLLLEYGANPHARSGPKGKRTLPEHLLPRDKVTPEFLALLQRAKATRKKAARPAQLCWCLSGEKFSDCHEEGKPVRDEAFCP… |
| A0A4Y9YSQ8 | 194-543 | None |
| A0A4Y7Q9F7 | 184-497 | None |
| A0A2H3BWJ3 | 3-341 | None |
| A0A4Y7QA33 | 9-326 | None |
| B8PAA6 | 186-515 | None |
| A0A0G4I4S5 | 155-495 | None |
| A0A165BRJ7 | 4-331 | None |
| A0A1X6MMT1 | 169-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.