DPCstruct | MC35979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 129 ± 16 aa |
| Standard deviation of domain lengths | 15.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4Z5L2 | 1-128 | MLFESVAITAALAASTSAQLSHNITRSCGTPLLTEAQIQASQQMLQDERVRIASGVRPLRALTVDTYFHAVAASKAEEDGYATEQQL… |
| A0A0G2E8P6 | 345-454 | RCAAPEPSEELLEVSRDMGLREAAAREAGISARQSGSITVDTWFHVVAASNSVANGYITDAMLADQLDVLNAHYAPHGISFTHAGTT… |
| H0EMJ7 | 1-156 | None |
| A0A6N9YBR5 | 1-130 | None |
| A0A3M7LYF6 | 40-184 | None |
| A0A0F7ZZT8 | 21-148 | None |
| A0A4Y9ZNF3 | 185-314 | None |
| A0A0A1T7U3 | 1-116 | None |
| A0A151GGV7 | 1-136 | None |
| A0A482SQQ3 | 35-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.