DPCstruct | MC35978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 353 ± 46 aa |
| Standard deviation of domain lengths | 46.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4Z3J7 | 1-312 | MIVCDIKTERAVDLTFHPYTLRISQFKDIGFSHPGSCYNASRSQEAERKSTEEMDSSDAPMGRAVENYMTARIVARGESPPDDAKQK… |
| A0A2J6S8C1 | 186-556 | KETFVDRAKPSVIAFIKDLLDIKERPATDIADNGIEMENVIDGRNIQTFKLNGRSVTKVKFDDTDVSKGKYQKLKTSVKFEKLVTKK… |
| A0A423XE64 | 99-513 | None |
| A0A4Q4TTA8 | 30-309 | None |
| A0A4Q4TIE5 | 64-417 | None |
| R8BQ95 | 3-386 | None |
| A0A4Q4YH21 | 95-452 | None |
| A0A4Q4Y1M9 | 97-451 | None |
| M7S9X7 | 107-374 | None |
| A0A423W7C4 | 99-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.