DPCstruct | MC35976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 303 |
|---|---|
| Mean domain length (aa) | 282 ± 61 aa |
| Standard deviation of domain lengths | 60.67 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 13.52 |
| Pfam Score | 99.50 |
| Assigned Pfam label(s) | CL0286- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4Y263 | 7-290 | IRFGVEIETPLVRTGNGDRDSIADSLLEELRNVKHLDIDIKWVLEDIVGFEFKSPVFDLGRDWRAQVRKLWETIGVRQSTTPEHFVH… |
| A0A663LSZ9 | 171-419 | RRIMDMVSNQHPWFGMEQEYTLLGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKIGGTNAEVMPAQWEF… |
| A0A139LKR3 | 8-235 | None |
| B1V1K4 | 89-364 | None |
| A0A4S9V562 | 2-412 | None |
| A0A0S7ZQI5 | 2-367 | None |
| A0A4Y8CQS8 | 1-429 | None |
| A0A1G2I264 | 80-322 | None |
| A0A496SRY9 | 159-387 | None |
| A0A194UWA7 | 335-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.