DPCstruct | MC35974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 7.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5MSD8 | 193-304 | EKYRLAIDFLRQQLREQPRTSVGGFWHKKVYPHQMWLDGLFMATPFLAQYAVFAKEPAAMDDAVKQLLLVAEKTFDPSTGLYTHAWD… |
| A0A4Q4XDM1 | 2-119 | LKDWRERTDDEKYKEVARVVREQSDKTPRTATGPRAGSGIATRIYPNQMWLDGMLDGGFFYAKWARLFDADNTTARDDIVLQFDNFE… |
| A0A4Q5X8S5 | 548-642 | None |
| A0A0S6W510 | 633-734 | None |
| Q5B659 | 396-504 | None |
| A0A194W2Z9 | 182-294 | None |
| A0A7K0KE11 | 598-697 | None |
| M2SXV5 | 113-219 | None |
| A0A2S5ADF3 | 112-226 | None |
| W4UU83 | 398-512 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.