DPCstruct | MC35969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 221 ± 30 aa |
| Standard deviation of domain lengths | 30.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1PFK9 | 412-621 | FLKLPEVHIGMEAVNATVNLHLPGNTWILWTNGPGMGPVVLFWSYLILLAIVSFGLAHLGWTPLKGWQWFLLGLGLTQIHVLEALVV… |
| A0A7W2TCY1 | 1-175 | MSSQRWILSAKGPLLESAVLYWGELLAFILLALLVSRVNFSPLNTVSWIILGFGLSLSNWGVLMLMSLWFAAITASTYRPKNINRLS… |
| A0A1V6DGR5 | 1-288 | None |
| A0A6B1HGY8 | 676-886 | None |
| A0A2P5M325 | 510-734 | None |
| A0A7J5WH12 | 788-1015 | None |
| A0A661DQ51 | 953-1180 | None |
| A0A534CP28 | 1-176 | None |
| A0A1V5L7V5 | 71-283 | None |
| A0A7X9FJ28 | 5-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.