DPCstruct | MC35966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 264 ± 68 aa |
| Standard deviation of domain lengths | 68.39 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 72.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383Z4N6 | 1-225 | MVSWPPSNLGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDAACQFSLKVTHYHCTRENCG… |
| B7PYR0 | 1-194 | MKMPSLRILKDEPVPDGYVRFRFNEDCSYRHCGYREHQTHFHCTRKDCGYSFCDKTRFVQHTARHERLDTLMGGDFRQFRANVHCGR… |
| A0A6H5HME9 | 1-309 | None |
| A0A1D3PCK9 | 1-140 | None |
| A0A6G0TV86 | 5-335 | None |
| A0A6F9D959 | 1-336 | None |
| A0A5N5T423 | 3-360 | None |
| A0A1J1J9A6 | 971-1197 | None |
| A0A7R9E2X4 | 567-881 | None |
| A0A453YZJ3 | 72-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.