DPCstruct | MC35964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 186 ± 28 aa |
| Standard deviation of domain lengths | 28.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0315 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6LM26 | 9-185 | LWSVRIVSSPFGPLDAGTLVYPLTFTLRDLIHRQAGAKAAEATIILAGALSAAAALGTWVVGAIPASPEVAQSAAQIHFGDVLSLAP… |
| A0A2E8V7Y0 | 5-178 | KLKTYISLILFLSYISIIFFANWSINKWGIVSIGLGLSAPAGVYFAGLAFSIRDGLHESSNKIWVSIAILIGALLSFLLEGGERIAL… |
| A0A7Y3J2Q9 | 11-221 | None |
| A0A2E4QW10 | 29-201 | None |
| A0A220VGM1 | 81-302 | None |
| A0A521TXR1 | 70-240 | None |
| A0A7C4M8X6 | 2-146 | None |
| A8EYQ1 | 1-178 | None |
| A0A4Q1K3Q4 | 21-236 | None |
| A0A1G3R9B9 | 6-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.