DPCstruct | MC35963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 340 ± 104 aa |
| Standard deviation of domain lengths | 104.31 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6UV04 | 57-324 | EAGQDTTTEALSNDFKPSSMAFSFAVAHGTKINLEIFAAKYKKQDQDNVWTRKPFEHIEDIVIENTVRKTIFDESATLDITVRSYKK… |
| A0A1M6FPG0 | 83-368 | SAEETPDGEDLGPDVEDGDEDVAPRRGLMIPASMGLRFQIPLGLESFTVRASWGKYNPRATEKEDDSGPQRPEYVRTPMDVAVRVRV… |
| A0A344UU85 | 1-299 | None |
| A0A5P8WGC9 | 1-425 | None |
| A0A381KJH1 | 4-525 | None |
| A0A439S4R6 | 51-383 | None |
| E6JZ17 | 70-316 | None |
| A0A7V1F535 | 1-549 | None |
| X5PQI4 | 77-414 | None |
| A0A519CZ91 | 2-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.