DPCstruct | MC3596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 136 ± 22 aa |
| Standard deviation of domain lengths | 21.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07837 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0WMU4 | 1-116 | MQKIVECVPNFSEGRTLKVINSIFDAAKIKGVKVFELEYNRDHNRMLFTIVGEPEAVLASVFESIKTATKLIDMNKHVGEHPRIGAT… |
| A0A7S3XW83 | 52-189 | SIFSNLYVSEGRDEQFINELHEMAHNKTGETFDCALVNKFSDPHYNRTSFCFAGHYSSVSRIIKEVAEVAIESLNLEEHEASHPRIG… |
| A0A670I790 | 1-163 | None |
| A0A6J7LPN8 | 2-124 | None |
| A0A7J6EXW9 | 141-288 | None |
| A0A7J8AEY4 | 3-144 | None |
| A0A671DX96 | 1-136 | None |
| A0A2N9ISC6 | 72-220 | None |
| A0A803Q6B8 | 182-345 | None |
| A0A7C6SC94 | 2-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.