DPCstruct | MC35957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 174 |
|---|---|
| Mean domain length (aa) | 177 ± 26 aa |
| Standard deviation of domain lengths | 26.16 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 16.89 |
| Pfam Score | 86.45 |
| Assigned Pfam label(s) | PF07589- PF13448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K7YSJ1 | 24-203 | ISIDELNFDQDYWTITDLSTNATGTSLFQIEVEQADYESNFGLYYIDDTSQSVTKFKVFDKSNEPITKVTISFLYDDSDWWITNNYT… |
| A0A259CD28 | 335-479 | ATTAGGADDQDVVVRLRQNGINDISVMFYEVDDFGGTIAGIAPGQAGYDAAAAARAYLTQDGLSAINGAGYGAYSQTEITGVDAGDY… |
| A0A2E6QP24 | 141-348 | None |
| A0A1H8MHK3 | 1003-1167 | None |
| A0A7G7EN62 | 76-260 | None |
| A0A521TVM2 | 78-262 | None |
| A0A521U829 | 27-219 | None |
| A0A7X6CGM3 | 120-325 | None |
| A0A368N0K8 | 68-245 | None |
| A0A1H8W9W4 | 569-744 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.