DPCstruct | MC3595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 246 |
|---|---|
| Mean domain length (aa) | 425 ± 92 aa |
| Standard deviation of domain lengths | 92.31 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.42 |
| Pfam Score | 82.69 |
| Assigned Pfam label(s) | PF07324- CL0221- PF13967- CL0416- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3XKI6 | 36-489 | YAYWLLVPAAAGLAYGAYAVAAGDPGESEGVNYYQVAFVTVVILWTVLYKTHWDQESALIAVAWGTHGFEEEEADRPQFRGWPEEPR… |
| A0A7S1R4A7 | 65-457 | DTAFIVFETRGGRDCALTASKKKALGLWGAVLKLQATTHEPESVFWEEFAVSQTEHLLREVKAFVYTVTCSILWTVILYLPYAHYMA… |
| W4GHV2 | 346-839 | None |
| A0A6A5UN88 | 254-655 | None |
| H0EVI8 | 122-552 | None |
| A0A7S4RV32 | 586-1054 | None |
| M2T989 | 82-475 | None |
| A0A7S1XUZ3 | 89-464 | None |
| A0A7S3ZRY5 | 2-432 | None |
| A0A7S4A2Z5 | 587-1088 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.