DPCstruct | MC35947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 98 ± 13 aa |
| Standard deviation of domain lengths | 13.36 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7HTB2 | 1-73 | MKQYKAVAGPKNINVDKGGTQTAFNMFADIINQEARGGWEYHSMETISVTEKPGCLQQAIPVNYYMLIFVKDV |
| A0A5B8I713 | 60-158 | MTQYEYKVLPAPARSDKIKGVKSAPDRFAATLSAALNEQAGNGWEFIRAETLPHEERQGLTGTKSTFQTVLVFRRPTEAELPQVEQA… |
| M9RLG4 | 1-110 | None |
| A0A1I1MRR2 | 1-113 | None |
| A0A4R2Q6X0 | 1-93 | None |
| A0A644U777 | 255-368 | None |
| A0A0P1IPI4 | 1-106 | None |
| A0A291FLT7 | 105-231 | None |
| A0A2R8AC67 | 1-94 | None |
| A0A2P6FKA5 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.