DPCstruct | MC35943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 206 ± 35 aa |
| Standard deviation of domain lengths | 35.13 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04664 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X0LQ30 | 25-228 | ESATSLTTVPSSRVLSFYQNHLPALPSRYHLDDHHTHLFHNYAQLESNHSFIQWWFPLRTPGVNAQAPLLTSNPRELIALRTDPGVQ… |
| A0A0Q7S4S4 | 3-145 | AITAFLEGEGPDARGRTLFDVLAMDNVALERNHDFIQWLFPLREPSRAVPEAPVLADTEVEAIRESVMAQCALAAATDRMDAFYRAT… |
| A0A815G3N2 | 121-361 | None |
| A0A0S4JSR1 | 368-619 | None |
| A0A1X7ANZ6 | 97-288 | None |
| A0A4S2MYD0 | 2-244 | None |
| A0A3N4J2R2 | 589-798 | None |
| A0A7J6CF19 | 65-315 | None |
| A0A2D0PMM5 | 30-256 | None |
| A0A1H2TXJ7 | 18-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.