DPCstruct | MC35942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Standard deviation of domain lengths | 15.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9QQN6 | 1-90 | MPAHPNNGDEQRYPSRFASYSKGLPHDSTGTVDPTAYQKMLFALGTGNPADFEAIPLGATRKLVNPQSAYSFTLVGPDPHALAIRPA… |
| A0A539CTJ3 | 12-134 | RVPRSFALRTETAGQDAFSPAPPEFDNGDEALYSDKSGTDTKGILQTGIGLVDLAAYETFKNALDSGTPADFEAITLGGPRTLNGPQ… |
| A0A6J4LXF7 | 192-328 | None |
| A5EER7 | 64-177 | None |
| A0A433VW62 | 80-226 | None |
| A0A522TDW4 | 36-166 | None |
| A0A7W1SX17 | 32-172 | None |
| A0A2V8P1W8 | 65-183 | None |
| A0A7Y3GIA3 | 79-203 | None |
| A0A4Y7RVX2 | 39-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.