DPCstruct | MC3594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 11.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834MCQ5 | 257-352 | NVSVYSIESFKSFDAVKLEYLGFCPWKLVETKGALIPGNPSMGVARYQEKNYVFSTVEASQEFCKNPELYVNYILDLAREKPQLIHF… |
| M7CMW6 | 760-870 | EQEWLFPETTSNFDQLLIQYRGFCAHTLAEKDGLLLPGNPAVGILKHKEKYYTFSSKESAYVFAQNPDTFIQLIGEKAKECAELIQL… |
| A0A7J6S1B9 | 272-376 | None |
| A0A6J1Z6F5 | 339-449 | None |
| A0A6I9NPB9 | 1-124 | None |
| A0A812Z9P3 | 23-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.