DPCstruct | MC35933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 231 ± 39 aa |
| Standard deviation of domain lengths | 39.19 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16226 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5U710 | 18-224 | KLTKINYIDPNLKNLTSIHGYIEELEEKKFNREAVNTQFQQLLDKYSISIPKDTNLTFTIDPYDYKVSVGGLEDKSLSSLIEDALNT… |
| A0A7U9R519 | 17-218 | AELEYVKIFANLKDMEKAQNKAELKNSFSDDFVKDLESMGISRDDIEGMQVRIGSNGDVSVDGIEDEGVREQVQKLIDEKYGDRMYQ… |
| A0A426DMB8 | 98-329 | None |
| A0A3R8JL07 | 270-488 | None |
| A0A844KSG6 | 1-207 | None |
| A0A1C0BA69 | 138-352 | None |
| A0A662ZDP0 | 51-364 | None |
| A0A3R6DC62 | 293-463 | None |
| R9IGE6 | 172-428 | None |
| A0A292QW18 | 100-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.