DPCstruct | MC3593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 176 ± 32 aa |
| Standard deviation of domain lengths | 31.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1INY1 | 19-166 | TDVSYHDMEEIDNMQSIPELESTLCSVFQIDLPEPKRGVLLELYVQTVLFCRECNFKQEQTSAILSIMKSIHETNVETPLNNIEQCF… |
| A0A6V1RZL7 | 9-190 | HFTEAQLRELEAARDPVECKGLLKSYLKIEDAGFDRDRQDILLDFHFYNYAFCKKLGFGPTKISTFLSIMKDTIDKDFSQHDAVNTI… |
| C1N195 | 4-134 | None |
| A0A7J6LFE8 | 10-227 | None |
| K3XA92 | 4-155 | None |
| A0A0G4HAH1 | 33-207 | None |
| A0A7S4NPP8 | 9-182 | None |
| A0A3Q0J2J5 | 13-202 | None |
| A0A6J3FRS8 | 31-216 | None |
| A0A835XP91 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.