DPCstruct | MC35929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 190 ± 21 aa |
| Standard deviation of domain lengths | 20.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3HC49 | 41-217 | PDRTTPAEPGPATVRKAVFGYAAHFVAGKQALVPAWLFAVEAPGAGEGDTFTVTYPAVKPEHIAGNGGSSAPGDRPTSGPAEPGGPG… |
| A0A7Y4MF62 | 19-221 | GIQVDPQETEAIFTALADLKEVGGIDAPMPLQQADVEEVNRAVLWMDDATAERSLGLLISPSNSADFSLETDWYVVLGRQGEQLRAT… |
| K6WPZ6 | 222-416 | None |
| A0A1Y2NQR3 | 306-472 | None |
| A0A5D0V3Z1 | 1-146 | None |
| A0A1H6EY04 | 54-248 | None |
| A0A6L9ST42 | 1-216 | None |
| A0A7K3WFD7 | 110-315 | None |
| A0A4R0KE82 | 43-248 | None |
| A0A132MS75 | 139-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.