DPCstruct | MC35923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 160 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 43.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396GNT6 | 1-126 | MFWEKQDVIMEALVKHFFVDGAVTSPLLMEILYNGYQSINADNTTAKFVRIEKNRFGLVGDVPSLINIVVGIGYKPMKVNTPTEEDY… |
| A0A426XTC9 | 2-153 | DSLYSGLRALEFQSKNVKGIARLVDLEELPSPMILIDKDLFVLADDVILLIERVVSDSLPHQPLPSKDDKCPQNRTKDGSSGDEFNK… |
| A0A072TT74 | 335-470 | None |
| A0A396GP21 | 101-225 | None |
| A0A452ZHT1 | 141-330 | None |
| A0A6A3CSS1 | 1-174 | None |
| A0A078GNK9 | 26-217 | None |
| A0A835R3B6 | 185-324 | None |
| A0A6D2LCF4 | 1-164 | None |
| A0A1D6FT01 | 179-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.