DPCstruct | MC3592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 140 ± 10 aa |
| Standard deviation of domain lengths | 9.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9YWI2 | 293-431 | QKKTDAPMPKPHRPDELPPTATADATIAYVAAALENINKTTLAPPPSVAPAVPSTERPFHFDAGSTDAKARFQLQDPALFDLTSIYR… |
| A0A6S9K3R8 | 1-142 | RGWPPRQIEGRSPRASSTRAGGGGGEHPPSPTADGPAPRATARRSNGPEAYQKYESGLVDFFDISSSADKGRFRVHDAKLFKADTMH… |
| F0WLC0 | 772-900 | None |
| A0A7S2C1F2 | 3-141 | None |
| A0A7J2YXQ7 | 5-131 | None |
| A0A7S3XYA5 | 1-161 | None |
| A0A836CK61 | 269-412 | None |
| A0A0W8DSL9 | 20-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.