DPCstruct | MC35918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 190 ± 21 aa |
| Standard deviation of domain lengths | 21.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J7B9U7 | 19-188 | TSTSAQATGDLYRYWSYWHSQDSISWSYSNEGATRVPADGTVEGWYFSVTNKSPQAAEAITIRANFSEYCKETKAVNGMKRVAVVVD… |
| A0A6J6E8P7 | 6-165 | IAISSIALLISYPSSVSQASTGYRYWGYFQAAPGATEWTMAMTGPTTNVKDGSVEGWMHTFSNDDVNASAPRRAPNFSSLCKSVKPV… |
| A0A7W5VPM6 | 1-202 | None |
| A0A6L6F0M6 | 22-203 | None |
| A0A1Q4WN69 | 8-208 | None |
| A0A327VFK0 | 1-187 | None |
| A0A1H9NVZ0 | 41-262 | None |
| C7NIK7 | 1-229 | None |
| A0A1M4E6L4 | 1-151 | None |
| A0A6J7D6L5 | 18-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.