DPCstruct | MC35917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 172 ± 20 aa |
| Standard deviation of domain lengths | 19.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A080ZQS6 | 10-166 | VEEADAAIALFTRHEGDPQQNLYDMQCMWYEIECGKSQLRQKKYGLALKRFFAVEKHFNDFVEDQFDFHTYCIRKMTLRAYIQMLRL… |
| A0A3L7HNT2 | 29-174 | IKEAEEMCSKFTREGTSAVENLNEMQCTWFQTECAQAYKAMNKFGEALKKCHEIERHFIEITDDQFDFHTYCMRKITLRSYVDLLKL… |
| A0A177BBJ5 | 432-600 | None |
| A0A814BPB3 | 446-637 | None |
| A0A2B4RBH8 | 295-429 | None |
| A0A426YZS4 | 2-162 | None |
| A0A0G2H191 | 916-1117 | None |
| A0A446PTA2 | 2-164 | None |
| A0A267G9H3 | 2-162 | None |
| A0A3L6DC95 | 242-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.