DPCstruct | MC35916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 134 ± 16 aa |
| Standard deviation of domain lengths | 15.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A080ZHR7 | 28-153 | VAIEADSCECKSTPRPCIFLHGLGNPNEKAELQDTPKLTKEKFGDIGDHAPCCTTVKYAVINTVDVGWRNDTLQQKFCDFSLSMSET… |
| T0PTR6 | 278-396 | IESASCGCKMAKKPCLFVHGAGNYFNASLSDIFLFEWGLAHLHAPCCSSIKFAHFETWFRGWEEESIHNQFCDAALQVSNAKPNSTS… |
| A0A397APR1 | 210-341 | None |
| A0A3F2RMM8 | 133-264 | None |
| A0A1Z4KDZ5 | 4-149 | None |
| W4GZZ5 | 3-123 | None |
| K3WWG0 | 97-252 | None |
| G4ZCP7 | 102-242 | None |
| D0NVD0 | 69-225 | None |
| D0NP22 | 20-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.