DPCstruct | MC35914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 181 ± 22 aa |
| Standard deviation of domain lengths | 21.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5A483 | 1-149 | MEQKQKRTYRKAGPFHVEFHGLQACLRSDKSRVNIKTMLVSHAFVDLWWLIREDRQYDKALFDQLDEHERDFMRYCLNKCKITSRQF… |
| A0A080YXR1 | 8-172 | TRRKGQTYNLNDIQNLATPSAYIYRKLGSKFIRLPDLDKKTQTICQPNRRKCGPMREISDSLQSMIKDLVFKNELSQDKYDKLSIDD… |
| A0A2E8NXR3 | 183-378 | None |
| A0A329RZ09 | 486-672 | None |
| A0A329RML7 | 354-522 | None |
| A0A0P1AKU3 | 519-689 | None |
| A0A0N7L3Z0 | 4-190 | None |
| G5A261 | 32-196 | None |
| A0A418AP30 | 120-320 | None |
| A0A0W8DZ03 | 210-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.