DPCstruct | MC3591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 222 ± 21 aa |
| Standard deviation of domain lengths | 20.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524NNB6 | 375-592 | PFMCYKAKNTSGTPKPAPGTVDLTDAIETGSFDAKKVKALCAPADKDDGGVVDDCTHLTSYQVKGPAHVKQSGIAATDAFGTWSIDT… |
| A0A7X0C3J5 | 5-246 | DLECFKTDPYQPPAVGLVLRHLNPVLGTLPTEQVTLGAREQLCVPVAKNNVIPPPGVLDFVRFVDLACYRVITPASGKALVLSHLNP… |
| A0A7C1J128 | 208-419 | None |
| A0A534Q6D5 | 240-475 | None |
| A0A846PBA3 | 118-324 | None |
| A0A534S4R5 | 72-308 | None |
| A0A534RJE0 | 152-377 | None |
| A0A849EDI7 | 2-255 | None |
| A0A534WK96 | 153-407 | None |
| A0A7Y1ZXI9 | 6-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.