DPCstruct | MC35907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 156 |
|---|---|
| Mean domain length (aa) | 275 ± 53 aa |
| Standard deviation of domain lengths | 52.93 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2AP06 | 11-247 | TMDLLAIALAPGFAIILFILYRDKFDREPAVVLLVSFFFGMLSTVPAIAIEDAVGYFNLSGIQGTVISAFLGVALVEELVKFIPLRL… |
| A0A1Y1S0Q1 | 5-225 | PIIMAIIPSLVLVLLFMRFDRRRPEPRGEILRAFVLGVFSTIPVLVLEILVDAFFSPWFTNPLYLAVLEAFVVAALCEEGIKLMVVR… |
| A0A7Y4ZSI3 | 74-319 | None |
| A0A2G2KDD2 | 44-299 | None |
| A0A537ZIX4 | 33-330 | None |
| A0A1H2UMM4 | 164-463 | None |
| A0A358SUD0 | 32-346 | None |
| A0A518AJ22 | 94-292 | None |
| A0A838RMR1 | 44-302 | None |
| A0A2E9IMY5 | 115-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.