DPCstruct | MC359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 4.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 83.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2J6B9 | 6-59 | EAKAKVAVDVDPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHADAHDFDSQT |
| A0A3P6G4D0 | 1-61 | MIIRSPEPEVKILVDRDPIKTSFEEWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTQ |
| A0A444X2Y5 | 67-126 | None |
| A0A6P5MEV9 | 1-51 | None |
| A0A2G3ASB3 | 1-51 | None |
| A0A4S8I2Y4 | 1-51 | None |
| B9RL07 | 1-51 | None |
| A0A5J5BHJ5 | 1-51 | None |
| A0A4Y7J9A2 | 1-60 | None |
| A0A816J1B2 | 1-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.