DPCstruct | MC35892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 224 |
|---|---|
| Mean domain length (aa) | 109 ± 19 aa |
| Standard deviation of domain lengths | 18.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.74 |
| Pfam Score | 85.51 |
| Assigned Pfam label(s) | CL0154- CL0548- CL0522 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q2CYH0 | 8-102 | FVSFALPVSTTETLPGLEIDAVVGVVVGIATRPRDMAHNPEMGYVNTAARQDAIGAMVQQAQEAGAHAIIGVRFDGGKISETVTELT… |
| A0A023CUG0 | 1-80 | MILGIVNATVKRTLTADRIDEVDQYDEMYNQVKEKLIERAAVKEGDGVIGVNFNSEIVRVAVGPKYMLLHGYGTAIKFPK |
| A0A7G9FCQ1 | 11-155 | None |
| G0TKP2 | 111-210 | None |
| A0A1I8IMS7 | 118-276 | None |
| A0A7C3MTE0 | 28-113 | None |
| A0A4W4G995 | 52-176 | None |
| A0A1W1EG60 | 1-103 | None |
| A0A368FCU2 | 85-188 | None |
| A0A2T6D016 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.