DPCstruct | MC35890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 123 ± 19 aa |
| Standard deviation of domain lengths | 19.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9LM21 | 120-227 | YPNSFSAGDIYAAIDDQEVCPATYLSGPDGSLIKYTLSRSAAEDTLFARVAGPPGMPHLSELSQIHKALQNLTMLPSDVVRLLAGAG… |
| A0A7Z6URH2 | 20-154 | LPDGYRVDGMYFCSANLAVEGGREVINDFFEPDDLHRMFSYRHKPAQRRKGLPIRYGFEMSAVYFSAADGALLCYTPSQSAEEVQLL… |
| A0A0Q0L3V6 | 22-127 | None |
| A0A7Y1CV67 | 418-523 | None |
| A0A7Y8RK52 | 410-517 | None |
| A0A656YMK1 | 125-222 | None |
| A0A3M2VSY0 | 311-471 | None |
| A0A0Q0GNL2 | 1-134 | None |
| A0A0P9PX72 | 122-229 | None |
| A0A267AAI2 | 98-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.