DPCstruct | MC3589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 138 ± 14 aa |
| Standard deviation of domain lengths | 14.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5XK33 | 1132-1260 | ASIAPESGIERIGINLTGVPTELREMFQELAQEPLSDAASLRDQVKQHVDAMAEAYQVNEFVDVAGAHTLAAQCTLLLDRWESLPAA… |
| A0A1E4F2L5 | 5-122 | SPNPADLPEGSQLDFQRLLAFPLETPERMRIAVERHLHNVREAASEYPQANQAVARQIAEELRELLGYGEETPLLHQQWIQAAARYF… |
| A0A356T3B2 | 160-299 | None |
| A0A511H549 | 237-346 | None |
| A0A367ZS83 | 1-134 | None |
| A0A0S8FIX5 | 1-151 | None |
| A0A4Y6PV17 | 100-248 | None |
| A0A7X7GUS8 | 34-183 | None |
| A0A5C6XNV4 | 125-280 | None |
| A0A1F9K9W6 | 135-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.