DPCstruct | MC35887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 8.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397UFQ4 | 20-131 | KEINQFVPLLGPLYISLNIQETCIIKFYPFFNELYKDIFNKKNLIAKPKPWQINLLLYIAHSRWIKIKFKVLKAFQNSKNSSFYSIL… |
| A0A6S7G8H9 | 80-186 | GPLHISLNSRECVLKMFQPIFAELYSFLFGKKAKLAMKPKPRRVSLLLEVIYGGWTLIRETVLSVFCHCKDIEFLTLVNLVDNYVPL… |
| A0A397JAU9 | 762-887 | None |
| A0A397JBK5 | 238-345 | None |
| A0A397JDW0 | 94-202 | None |
| A0A397JHZ6 | 434-541 | None |
| A0A6S7FNW3 | 155-260 | None |
| A0A2N0R0H5 | 122-229 | None |
| A0A2I1FE22 | 168-277 | None |
| U9TN26 | 131-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.