DPCstruct | MC35885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 155 ± 35 aa |
| Standard deviation of domain lengths | 35.29 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397UBS1 | 158-280 | FQELESAYHEACAELNEAKLGSISLSKKIKLMAWVLYTRQRSYSERPILDPEEFKKMLEESEPSLKGFFDQLVAGTNPQTKSYMTNE… |
| A0A397U1K5 | 1-134 | MPTKNLGPCLIIGCTNTNVQFRTITALAYEKCQRKRTLEAYPYLEIGKQLCHPHYCKLVKPYIKKHVQTENNTFASSIDMLTKALYY… |
| A0A397UAG8 | 4-125 | None |
| A0A397UFT9 | 1-168 | None |
| A0A397UI99 | 1-176 | None |
| A0A397JAU9 | 218-375 | None |
| A0A397JE81 | 1-89 | None |
| A0A397IF15 | 1-244 | None |
| A0A397JRQ5 | 193-434 | None |
| A0A397JZ48 | 1-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.